Lineage for d1lo0h1 (1lo0 H:1-119)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158571Species Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain [74810] (4 PDB entries)
  8. 158572Domain d1lo0h1: 1lo0 H:1-119 [74115]
    Other proteins in same PDB: d1lo0h2, d1lo0l2, d1lo0x2, d1lo0y2

Details for d1lo0h1

PDB Entry: 1lo0 (more details), 2 Å

PDB Description: Catalytic Retro-Diels-Alderase Transition State Analogue Complex

SCOP Domain Sequences for d1lo0h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo0h1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain}
evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsa

SCOP Domain Coordinates for d1lo0h1:

Click to download the PDB-style file with coordinates for d1lo0h1.
(The format of our PDB-style files is described here.)

Timeline for d1lo0h1: