Lineage for d1lnyb_ (1lny B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869014Protein Adenylosuccinate synthetase, PurA [52655] (5 species)
    common fold is interrupted by an all-alpha subdomain, residues 100-200
  7. 2869046Species Mouse (Mus musculus) [TaxId:10090] [69491] (9 PDB entries)
  8. 2869053Domain d1lnyb_: 1lny B: [74114]
    complexed with gdp, imo, mg
    has additional subdomain(s) that are not in the common domain

Details for d1lnyb_

PDB Entry: 1lny (more details), 2.2 Å

PDB Description: crystal structure of the recombinant mouse-muscle adenylosuccinate synthetase complexed with 6-phosphoryl-imp, gdp and mg
PDB Compounds: (B:) adenylosuccinate synthetase

SCOPe Domain Sequences for d1lnyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnyb_ c.37.1.10 (B:) Adenylosuccinate synthetase, PurA {Mouse (Mus musculus) [TaxId: 10090]}
aatgsrvtvvlgaqwgdegkgkvvdllatdadivsrcqggnnaghtvvvdgkeydfhllp
sgiintkavsfigngvvihlpglfeeaeknekkglkdwekrliisdrahlvfdfhqavdg
lqevqrqaqegknigttkkgigptysskaartglricdllsdfdefsarfknlahqhqsm
fptleidvegqlkrlkgfaerirpmvrdgvyfmyealhgppkkvlveganaalldidfgt
ypfvtssnctvggvctglgippqnigdvygvvkayttrvgigafpteqineigdllqnrg
hewgvttgrkrrcgwldlmilryahmvngftalaltkldildvlseikvgisyklngkri
pyfpanqeilqkveveyetlpgwkadttgarkwedlppqaqsyvrfvenhmgvavkwvgv
gksresmiqlf

SCOPe Domain Coordinates for d1lnyb_:

Click to download the PDB-style file with coordinates for d1lnyb_.
(The format of our PDB-style files is described here.)

Timeline for d1lnyb_: