Lineage for d1lnuc2 (1lnu C:1-83)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190293Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 190294Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 190295Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 190467Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)
  7. 190538Species Mouse (Mus musculus), I-AB [TaxId:10090] [75379] (1 PDB entry)
  8. 190541Domain d1lnuc2: 1lnu C:1-83 [74102]
    Other proteins in same PDB: d1lnua1, d1lnub1, d1lnuc1, d1lnud1, d1lnue1, d1lnuf1, d1lnug1, d1lnuh1

Details for d1lnuc2

PDB Entry: 1lnu (more details), 2.5 Å

PDB Description: crystal structure of class ii mhc molecule iab bound to ealpha3k peptide

SCOP Domain Sequences for d1lnuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnuc2 d.19.1.1 (C:1-83) MHC class II, N-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AB}
ieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqgg
lqniavvkhnlgvltkrsnstpa

SCOP Domain Coordinates for d1lnuc2:

Click to download the PDB-style file with coordinates for d1lnuc2.
(The format of our PDB-style files is described here.)

Timeline for d1lnuc2: