SCOPe 2.07: Domain d1lnua1: 1lnu A:84-182

Lineage for d1lnua1 (1lnu A:84-182)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (31 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d1lnua1: 1lnu A:84-182 [74097]
   Other proteins in same PDB: d1lnua2, d1lnub1, d1lnub2, d1lnuc2, d1lnud1, d1lnud2, d1lnue2, d1lnuf1, d1lnuf2, d1lnug2, d1lnuh1, d1lnuh2
   complexed with nag, ndg

Details for d1lnua1

PDB Entry: 1lnu, 2.5 Å

PDB Description: crystal structure of class ii mhc molecule iab bound to ealpha3k peptide

PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-B alpha chain

SCOPe Domain Sequences for d1lnua1:

Sequence; same for both SEQRES and ATOM records:

>d1lnua1 b.1.1.2 (A:84-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnrd
ysfhklsyltfipsdddiydckvehwgleepvlkhwepe

Timeline for d1lnua1:

• d1lnua1 first appeared in SCOP 1.61
  
• d1lnua1 appears in SCOPe 2.06
  
• d1lnua1 appears in the current release, SCOPe 2.08