SCOP 1.73: Domain d1lnqh2: 1lnq H:19-98

Lineage for d1lnqh2 (1lnq H:19-98)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)

6. Protein Potassium channel-related protein MthK [75643] (1 species)
   calcium gated potassium channel

7. Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [75644] (1 PDB entry)

8. Domain d1lnqh2: 1lnq H:19-98 [74064]
   Other proteins in same PDB: d1lnqa3, d1lnqa4, d1lnqb3, d1lnqb4, d1lnqc3, d1lnqc4, d1lnqd3, d1lnqd4, d1lnqe3, d1lnqe4, d1lnqf3, d1lnqf4, d1lnqg3, d1lnqg4, d1lnqh3, d1lnqh4
   complexed with ca

Details for d1lnqh2

PDB Entry: 1lnq, 3.3 Å

PDB Description: crystal structure of mthk at 3.3 a

PDB Compounds: (H:) potassium channel related protein

SCOP Domain Sequences for d1lnqh2:

Sequence; same for both SEQRES and ATOM records:

>d1lnqh2 f.14.1.1 (H:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]}
patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
livlgigtfavaverllefl

Timeline for d1lnqh2:

• d1lnqh2 first appeared in SCOP 1.61
  
• d1lnqh2 appears in SCOP 1.71
  
• d1lnqh2 appears in SCOP 1.75
  
• d1lnqh2 appears in the current release, SCOPe 2.08