Lineage for d1lnqf2 (1lnq F:19-98)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 619951Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 619952Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) (S)
  5. 619953Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)
  6. 620001Protein Potassium channel-related protein MthK [75643] (1 species)
    calcium gated potassium channel
  7. 620002Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [75644] (1 PDB entry)
  8. 620008Domain d1lnqf2: 1lnq F:19-98 [74060]
    Other proteins in same PDB: d1lnqa3, d1lnqa4, d1lnqb3, d1lnqb4, d1lnqc3, d1lnqc4, d1lnqd3, d1lnqd4, d1lnqe3, d1lnqe4, d1lnqf3, d1lnqf4, d1lnqg3, d1lnqg4, d1lnqh3, d1lnqh4

Details for d1lnqf2

PDB Entry: 1lnq (more details), 3.3 Å

PDB Description: crystal structure of mthk at 3.3 a

SCOP Domain Sequences for d1lnqf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnqf2 f.14.1.1 (F:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus}
patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
livlgigtfavaverllefl

SCOP Domain Coordinates for d1lnqf2:

Click to download the PDB-style file with coordinates for d1lnqf2.
(The format of our PDB-style files is described here.)

Timeline for d1lnqf2: