![]() | Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) |
![]() | Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
![]() | Superfamily f.2.1: Membrane all-alpha [56869] (13 families) ![]() |
![]() | Family f.2.1.11: Oligomeric gated channels [63383] (4 proteins) |
![]() | Protein Potassium channel-related protein MthK [75643] (1 species) |
![]() | Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [75644] (1 PDB entry) |
![]() | Domain d1lnqd2: 1lnq D:19-98 [74056] Other proteins in same PDB: d1lnqa1, d1lnqb1, d1lnqc1, d1lnqd1, d1lnqe1, d1lnqf1, d1lnqg1, d1lnqh1 |
PDB Entry: 1lnq (more details), 3.3 Å
SCOP Domain Sequences for d1lnqd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnqd2 f.2.1.11 (D:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus} patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt livlgigtfavaverllefl
Timeline for d1lnqd2: