SCOP 1.61: Domain d1lnqc2: 1lnq C:19-98

Lineage for d1lnqc2 (1lnq C:19-98)

1. Root: SCOP 1.61

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (13 families)

5. Family f.2.1.11: Oligomeric gated channels [63383] (4 proteins)

6. Protein Potassium channel-related protein MthK [75643] (1 species)

7. Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [75644] (1 PDB entry)

8. Domain d1lnqc2: 1lnq C:19-98 [74054]
   Other proteins in same PDB: d1lnqa1, d1lnqb1, d1lnqc1, d1lnqd1, d1lnqe1, d1lnqf1, d1lnqg1, d1lnqh1

Details for d1lnqc2

PDB Entry: 1lnq, 3.3 Å

PDB Description: crystal structure of mthk at 3.3 a

SCOP Domain Sequences for d1lnqc2:

Sequence; same for both SEQRES and ATOM records:

>d1lnqc2 f.2.1.11 (C:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus}
patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
livlgigtfavaverllefl

Timeline for d1lnqc2:

• d1lnqc2 is new in SCOP 1.61
  
• d1lnqc2 appears in SCOP 1.63
  
• d1lnqc2 appears in the current release, SCOPe 2.08