Lineage for d1lnib_ (1lni B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 713695Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 713696Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 713697Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)
  6. 713841Protein RNase Sa [53935] (1 species)
  7. 713842Species Streptomyces aureofaciens [TaxId:1894] [53936] (22 PDB entries)
  8. 713844Domain d1lnib_: 1lni B: [74047]
    complexed with gol, so4

Details for d1lnib_

PDB Entry: 1lni (more details), 1 Å

PDB Description: crystal structure analysis of a ribonuclease from streptomyces aureofaciens at atomic resolution (1.0 a)
PDB Compounds: (B:) guanyl-specific ribonuclease sa

SCOP Domain Sequences for d1lnib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnib_ d.1.1.2 (B:) RNase Sa {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

SCOP Domain Coordinates for d1lnib_:

Click to download the PDB-style file with coordinates for d1lnib_.
(The format of our PDB-style files is described here.)

Timeline for d1lnib_: