Lineage for d1lnga_ (1lng A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.201: SRP19 [69694] (1 superfamily) Superfamily d.201.1: SRP19 [69695] (1 family) 
Family d.201.1.1: SRP19 [69696] (1 protein) Protein SRP19 [69697] (3 species) 
Species Archaeon Methanococcus jannaschii [TaxId:2190] [75417] (2 PDB entries) 
Domain d1lnga_: 1lng A: [74045]
Details for d1lnga_
PDB Entry: 1lng (more details), 2.3 Å
PDB Description: crystal structure of the srp19-7s.s srp rna complex of m. jannaschii
SCOP Domain Sequences for d1lnga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnga_ d.201.1.1 (A:) SRP19 {Archaeon Methanococcus jannaschii}
miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
cgcvevdykgnklqllkeickiikgkn
SCOP Domain Coordinates for d1lnga_:
Click to download the PDB-style file with coordinates for d1lnga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lnga_:
- d1lnga_ is new in SCOP 1.61
- d1lnga_ appears in SCOP 1.63
- d1lnga_ appears in the current release, SCOPe 2.08
View in 3D