Lineage for d1lnga_ (1lng A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 199732Fold d.201: SRP19 [69694] (1 superfamily)
  4. 199733Superfamily d.201.1: SRP19 [69695] (1 family) (S)
  5. 199734Family d.201.1.1: SRP19 [69696] (1 protein)
  6. 199735Protein SRP19 [69697] (3 species)
  7. 199739Species Archaeon Methanococcus jannaschii [TaxId:2190] [75417] (2 PDB entries)
  8. 199740Domain d1lnga_: 1lng A: [74045]

Details for d1lnga_

PDB Entry: 1lng (more details), 2.3 Å

PDB Description: crystal structure of the srp19-7s.s srp rna complex of m. jannaschii

SCOP Domain Sequences for d1lnga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnga_ d.201.1.1 (A:) SRP19 {Archaeon Methanococcus jannaschii}
miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
cgcvevdykgnklqllkeickiikgkn

SCOP Domain Coordinates for d1lnga_:

Click to download the PDB-style file with coordinates for d1lnga_.
(The format of our PDB-style files is described here.)

Timeline for d1lnga_: