Lineage for d1ln6a_ (1ln6 A:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519521Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 519522Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families) (S)
  5. 519612Family f.13.1.2: Rhodopsin-like [81320] (1 protein)
    Individual TM segments have a number of kinks and distortions
  6. 519613Protein Rhodopsin [56876] (1 species)
  7. 519614Species Cow (Bos taurus) [TaxId:9913] [56877] (7 PDB entries)
  8. 519624Domain d1ln6a_: 1ln6 A: [74044]

Details for d1ln6a_

PDB Entry: 1ln6 (more details)

PDB Description: structure of bovine rhodopsin (metarhodopsin ii)

SCOP Domain Sequences for d1ln6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ln6a_ f.13.1.2 (A:) Rhodopsin {Cow (Bos taurus)}
laaymfllimlgfpinfltlyvtvqhkklrtplnyillnlavadlfmvfggftttlytsl
hgyfvfgptgcnlegffatlggeialwslvvlaieryvvvckpmsnfrfgenhaimgvaf
twvmalacaapplvgwsryipegmqcscgidyytpheetnnesfviymfvvhfiiplivi
ffcygqlvftvkeaaaqqqesattqkaekevtrmviimviaflicwlpyagvafyifthq
gsdfgpifmtipaffaktsavynpviyimmnkqfrncmvttlccgknplgddeasttvsk
tetsqvapa

SCOP Domain Coordinates for d1ln6a_:

Click to download the PDB-style file with coordinates for d1ln6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ln6a_: