Lineage for d1ln4a1 (1ln4 A:1-97)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2523683Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2523980Superfamily d.68.4: YhbY-like [75471] (1 family) (S)
    automatically mapped to Pfam PF01985
  5. 2523981Family d.68.4.1: YhbY-like [75472] (3 proteins)
    Pfam PF01985
  6. 2523985Protein hypothetical protein YhbY [75473] (1 species)
  7. 2523986Species Escherichia coli [TaxId:562] [75474] (1 PDB entry)
  8. 2523987Domain d1ln4a1: 1ln4 A:1-97 [74043]
    Other proteins in same PDB: d1ln4a2
    structural genomics

Details for d1ln4a1

PDB Entry: 1ln4 (more details), 1.5 Å

PDB Description: crystal structure of e. coli yhby
PDB Compounds: (A:) Hypothetical protein yhbY

SCOPe Domain Sequences for d1ln4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ln4a1 d.68.4.1 (A:1-97) hypothetical protein YhbY {Escherichia coli [TaxId: 562]}
mdlstkqkqhlkglahplkpvvllgsngltegvlaeieqalehhelikvkiatedretkt
liveaivretgacnvqvigktlvlyrptkerkislpl

SCOPe Domain Coordinates for d1ln4a1:

Click to download the PDB-style file with coordinates for d1ln4a1.
(The format of our PDB-style files is described here.)

Timeline for d1ln4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ln4a2