Lineage for d1ln3a_ (1ln3 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582179Family d.129.3.2: STAR domain [55966] (5 proteins)
    automatically mapped to Pfam PF01852
  6. 2582187Protein Phosphatidylcholine transfer protein [75547] (1 species)
  7. 2582188Species Human (Homo sapiens) [TaxId:9606] [75548] (3 PDB entries)
  8. 2582190Domain d1ln3a_: 1ln3 A: [74041]
    complexed with cpl

Details for d1ln3a_

PDB Entry: 1ln3 (more details), 2.9 Å

PDB Description: structure of human phosphatidylcholine transfer protein in complex with palmitoyl-linoleoyl phosphatidylcholine (seleno-met protein)
PDB Compounds: (A:) Phosphatidylcholine transfer protein

SCOPe Domain Sequences for d1ln3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ln3a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]}
fseeqfweacaelqqpalagadwqllvetsgisiyrlldkktglyeykvfgvledcsptl
ladiymdsdyrkqwdqyvkelyeqecngetvvywevkypfpmsnrdyvylrqrrdldmeg
rkihvilarstsmpqlgersgvirvkqykqslaiesdgkkgskvfmyyfdnpggqipswl
inwaakngvpnflkdmaracqny

SCOPe Domain Coordinates for d1ln3a_:

Click to download the PDB-style file with coordinates for d1ln3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ln3a_: