SCOPe 2.07: Domain d1ln2b_: 1ln2 B:

Lineage for d1ln2b_ (1ln2 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.2: STAR domain [55966] (5 proteins)
   automatically mapped to Pfam PF01852

6. Protein Phosphatidylcholine transfer protein [75547] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75548] (3 PDB entries)

8. Domain d1ln2b_: 1ln2 B: [74040]
   complexed with dlp

Details for d1ln2b_

PDB Entry: 1ln2, 2.9 Å

PDB Description: crystal structure of human phosphatidylcholine transfer protein in complex with dilinoleoylphosphatidylcholine (seleno-met protein)

PDB Compounds: (B:) Phosphatidylcholine transfer protein

SCOPe Domain Sequences for d1ln2b_:

Sequence; same for both SEQRES and ATOM records:

>d1ln2b_ d.129.3.2 (B:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]}
fseeqfweacaelqqpalagadwqllvetsgisiyrlldkktglyeykvfgvledcsptl
ladiymdsdyrkqwdqyvkelyeqecngetvvywevkypfpmsnrdyvylrqrrdldmeg
rkihvilarstsmpqlgersgvirvkqykqslaiesdgkkgskvfmyyfdnpggqipswl
inwaakngvpnflkdmaracqny

Timeline for d1ln2b_:

• d1ln2b_ first appeared in SCOP 1.61
  
• d1ln2b_ appears in SCOPe 2.06
  
• d1ln2b_ appears in the current release, SCOPe 2.08