Lineage for d1lm8v_ (1lm8 V:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1301408Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1301558Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 1301559Family b.3.3.1: VHL [49469] (2 proteins)
  6. 1301560Protein VHL [49470] (1 species)
  7. 1301561Species Human (Homo sapiens) [TaxId:9606] [49471] (7 PDB entries)
  8. 1301562Domain d1lm8v_: 1lm8 V: [74035]
    Other proteins in same PDB: d1lm8b_, d1lm8c_
    complexed with Hif-1alpha oxyproline peptide (chain H)

Details for d1lm8v_

PDB Entry: 1lm8 (more details), 1.85 Å

PDB Description: structure of a hif-1a-pvhl-elonginb-elonginc complex
PDB Compounds: (V:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d1lm8v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lm8v_ b.3.3.1 (V:) VHL {Human (Homo sapiens) [TaxId: 9606]}
rpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlf
rdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrld
ivrslyedledhpnvqkdlerltqeriahq

SCOPe Domain Coordinates for d1lm8v_:

Click to download the PDB-style file with coordinates for d1lm8v_.
(The format of our PDB-style files is described here.)

Timeline for d1lm8v_: