Lineage for d1lm3d_ (1lm3 D:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (14 superfamilies) Superfamily a.24.3: Cytochromes [47175] (2 families) 
Family a.24.3.1: Cytochrome b562 [47176] (1 protein) Protein Cytochrome b562 [47177] (1 species) Species Escherichia coli [TaxId:562] [47178] (5 PDB entries) 
Domain d1lm3d_: 1lm3 D: [74028]
Details for d1lm3d_
PDB Entry: 1lm3 (more details), 2.7 Å
PDB Description: a multi-generation analysis of cytochrome b562 redox variants: evolutionary strategies for modulating redox potential revealed using a library approach
SCOP Domain Sequences for d1lm3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lm3d_ a.24.3.1 (D:) Cytochrome b562 {Escherichia coli}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
irhgydilvgqiddalklanegkvkeaqaaaeqlkttrnayhqkyl
SCOP Domain Coordinates for d1lm3d_:
Click to download the PDB-style file with coordinates for d1lm3d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lm3d_:
- d1lm3d_ is new in SCOP 1.61
- d1lm3d_ appears in SCOP 1.63
- d1lm3d_ appears in the current release, SCOPe 2.08
View in 3D
