Lineage for d1llza2 (1llz A:439-1239)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080028Protein Alpha subunit of glutamate synthase, central and FMN domains [69381] (2 species)
    Central domain (residues 423-780) may be a rudiment form of the FMN domain
  7. 2080038Species Synechocystis sp. [TaxId:1143] [75055] (5 PDB entries)
  8. 2080044Domain d1llza2: 1llz A:439-1239 [74021]
    Other proteins in same PDB: d1llza1, d1llza3
    complexed with f3s, fmn

Details for d1llza2

PDB Entry: 1llz (more details), 3 Å

PDB Description: Structural studies on the synchronization of catalytic centers in glutamate synthase: reduced enzyme
PDB Compounds: (A:) Ferredoxin-dependent glutamate synthase

SCOPe Domain Sequences for d1llza2:

Sequence, based on SEQRES records: (download)

>d1llza2 c.1.4.1 (A:439-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]}
daqtvlqqqaafgytaedvemvvvpmasqgkeptfcmgddtplavlshkprllydyfkqr
faqvtnppidplrenlvmslamflgkrgnllepkaesartiklrsplvnevelqaiktgq
lqvaevstlydldgvnsledaltnlvktaiatvqagaeilvltdrpngailtenqsfipp
llavgavhhhliraglrlkaslivdtaqcwsthhfaclvgygasaicpylalesvrqwwl
dektqklmengrldridlptalknyrqsveaglfkilskmgisllasyhgaqifeaiglg
aelveyafagttsrvggltiadvagevmvfhgmafpemakklenfgfvnyrpggeyhmns
pemskslhkavaaykvggngnngeaydhyelyrqylkdrpvtalrdlldfnadqpaisle
evesvesivkrfctggmslgalsreahetlaiamnrlgaksnsgeggedvvryltlddvd
segnsptlphlhglqngdtansaikqiasgrfgvtpeylmsgkqleikmaqgakpgeggq
lpgkkvseyiamlrrskpgvtlisppphhdiysiedlaqliydlhqinpeaqvsvklvae
igigtiaagvakanadiiqisghdggtgasplssikhagspwelgvtevhrvlmenqlrd
rvllradgglktgwdvvmaalmgaeeygfgsiamiaegcimarvchtnncpvgvatqqer
lrqrfkgvpgqvvnffyfiaeevrsllahlgyrslddiigrtdllkvrsdvqlsktqnlt
ldcllnlpdtkqnrqwlnhep

Sequence, based on observed residues (ATOM records): (download)

>d1llza2 c.1.4.1 (A:439-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]}
daqtvlqqqaafgytaedvemvvvpmasqgkeptfcmgddtplavlshkprllydyfkqr
faqvtnppidplrenlvmslamflgkrgnllepkaeklrsplvnevelqaiktgqlqvae
vstlydldgvnsledaltnlvktaiatvqagaeilvltdrpngailtenqsfippllavg
avhhhliraglrlkaslivdtaqcwsthhfaclvgygasaicpylalesvrqwwldektq
klmengrldridlptalknyrqsveaglfkilskmgisllasyhgaqifeaiglgaelve
yafagttsrvggltiadvagevmvfhgmafpemakklenfgfvnyrpggeyhmnspemsk
slhkavaayydhyelyrqylkdrpvtalrdlldfnadqpaisleevesvesivkrfctgg
mslgalsreahetlaiamnrlgaksnsgeggedvvryltlddvdsegnsptlphlhglqn
gdtansaikqiasgrfgvtpeylmsgkqleikmaqgakpgeggqlpgkkvseyiamlrrs
kpgvtlisppphhdiysiedlaqliydlhqinpeaqvsvklvaeigigtiaagvakanad
iiqisghdggtgasplssikhagspwelgvtevhrvlmenqlrdrvllradgglktgwdv
vmaalmgaeeygfgsiamiaegcimarvchtnncpvgvatqqerlrqrfkgvpgqvvnff
yfiaeevrsllahlgyrslddiigrtdllkvrsdvqlsktqnltldcllnlpdtkqnrqw
lnhep

SCOPe Domain Coordinates for d1llza2:

Click to download the PDB-style file with coordinates for d1llza2.
(The format of our PDB-style files is described here.)

Timeline for d1llza2: