Lineage for d1llwa1 (1llw A:1240-1507)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676845Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 676986Superfamily b.80.4: Alpha subunit of glutamate synthase, C-terminal domain [69336] (1 family) (S)
  5. 676987Family b.80.4.1: Alpha subunit of glutamate synthase, C-terminal domain [69337] (1 protein)
    this is a repeat family; one repeat unit is 1ea0 A:1280-1300 found in domain
  6. 676988Protein Alpha subunit of glutamate synthase, C-terminal domain [69338] (2 species)
    Central domain (residues 423-780) may be a rudiment form of the FMN domain
  7. 676992Species Synechocystis sp. [TaxId:1143] [75027] (5 PDB entries)
  8. 676997Domain d1llwa1: 1llw A:1240-1507 [74017]
    Other proteins in same PDB: d1llwa2, d1llwa3
    complexed with 2og, f3s, fmn

Details for d1llwa1

PDB Entry: 1llw (more details), 2.7 Å

PDB Description: Structural studies on the synchronization of catalytic centers in glutamate synthase: complex with 2-oxoglutarate
PDB Compounds: (A:) Ferredoxin-dependent glutamate synthase

SCOP Domain Sequences for d1llwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llwa1 b.80.4.1 (A:1240-1507) Alpha subunit of glutamate synthase, C-terminal domain {Synechocystis sp. [TaxId: 1143]}
vhsngpvldddiladpdiqeainhqttatktyrlvntdrtvgtrlsgaiakkygnngfeg
nitlnfqgaagqsfgafnldgmtlhlqgeandyvgkgmnggeivivphpqasfapednvi
igntclygatggnlyangragerfavrnsvgkaviegagdhcceymtggvivvlgpvgrn
vgagmtgglayfldevgdlpekinpeiitlqritaskgeeqlkslitahvehtgspkgka
ilanwsdylgkfwqavppsekdspeann

SCOP Domain Coordinates for d1llwa1:

Click to download the PDB-style file with coordinates for d1llwa1.
(The format of our PDB-style files is described here.)

Timeline for d1llwa1: