Lineage for d1llrh_ (1llr H:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228614Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 228615Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 228616Species Vibrio cholerae [TaxId:666] [50209] (12 PDB entries)
  8. 228636Domain d1llrh_: 1llr H: [74016]
    complexed with fng, lnq

Details for d1llrh_

PDB Entry: 1llr (more details), 1.46 Å

PDB Description: cholera toxin b-pentamer with ligand bmsc-0012

SCOP Domain Sequences for d1llrh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llrh_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1llrh_:

Click to download the PDB-style file with coordinates for d1llrh_.
(The format of our PDB-style files is described here.)

Timeline for d1llrh_: