Lineage for d1llre_ (1llr E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2058420Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2058421Protein Cholera toxin [50208] (2 species)
    barrel, partly opened; n*=5, S*=10
  7. 2058428Species Vibrio cholerae [TaxId:666] [50209] (26 PDB entries)
    Uniprot P01556 22-124
  8. 2058485Domain d1llre_: 1llr E: [74013]
    complexed with fng

Details for d1llre_

PDB Entry: 1llr (more details), 1.46 Å

PDB Description: cholera toxin b-pentamer with ligand bmsc-0012
PDB Compounds: (E:) cholera toxin b subunit

SCOPe Domain Sequences for d1llre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llre_ b.40.2.1 (E:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1llre_:

Click to download the PDB-style file with coordinates for d1llre_.
(The format of our PDB-style files is described here.)

Timeline for d1llre_: