![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species) includes C-terminal additional subdomains |
![]() | Species Pig roundworm (Ascaris suum) [TaxId:6253] [75117] (2 PDB entries) |
![]() | Domain d1llqb1: 1llq B:296-593 [74010] Other proteins in same PDB: d1llqa2, d1llqb2 complexed with nad |
PDB Entry: 1llq (more details), 2.3 Å
SCOPe Domain Sequences for d1llqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1llqb1 c.2.1.7 (B:296-593) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} iqgtasvivaglltctrvtkklvsqekylffgagaastgiaemivhqmqnegiskeeacn riylmdidglvtknrkemnprhvqfakdmpettsileviraarpgaligastvrgafnee viramaeinerpiifalsnptskaectaeeaytftngaalyasgspfpnfelnghtykpg qgnnayifpgvalgtilfqirhvdndlfllaakkvascvtedslkvgrvypqlkeireis iqiavemakycykngtanlypqpedlekyvraqvynteyeelinatydwpeqdmrhgf
Timeline for d1llqb1: