Lineage for d1llqa2 (1llq A:2-295)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 587802Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 587803Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 587943Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins)
    Pfam 00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand
  6. 587950Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)
  7. 588011Species Pig roundworm (Ascaris suum) [TaxId:6253] [75254] (2 PDB entries)
  8. 588014Domain d1llqa2: 1llq A:2-295 [74009]
    Other proteins in same PDB: d1llqa1, d1llqb1

Details for d1llqa2

PDB Entry: 1llq (more details), 2.3 Å

PDB Description: Crystal Structure of Malic Enzyme from Ascaris suum Complexed with Nicotinamide Adenine Dinucleotide

SCOP Domain Sequences for d1llqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1llqa2 c.58.1.3 (A:2-295) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum)}
svahhedvyshnlppmdekemalyklyrpervtpkkrsaellkeprlnkgmgfslyerqy
lglhgllppafmtqeqqayrvitklreqpndlaryiqldglqdrneklfyrvvcdhvkel
mpivytptvglacqnfgyiyrkpkglyitindnsvskiyqilsnwheedvraivvtdger
ilglgdlgaygigipvgklalyvalggvqpkwclpvlldvgtnnmdllndpfyiglrhkr
vrgkdydtlldnfmkactkkygqktliqfedfanpnafrlldkyqdkytmfndd

SCOP Domain Coordinates for d1llqa2:

Click to download the PDB-style file with coordinates for d1llqa2.
(The format of our PDB-style files is described here.)

Timeline for d1llqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1llqa1