![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (15 families) ![]() |
![]() | Family c.68.1.14: Glycogenin [75273] (1 protein) |
![]() | Protein Glycogenin [75274] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [75275] (9 PDB entries) |
![]() | Domain d1ll3a_: 1ll3 A: [74006] complexed with gol |
PDB Entry: 1ll3 (more details), 1.9 Å
SCOP Domain Sequences for d1ll3a_:
Sequence, based on SEQRES records: (download)
>d1ll3a_ c.68.1.14 (A:) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptm thpqflnvwwdifttsvvpllqqfgl
>d1ll3a_ c.68.1.14 (A:) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsemthpqf lnvwwdifttsvvpllqqfgl
Timeline for d1ll3a_: