Lineage for d1ll0i_ (1ll0 I:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 248321Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 248322Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (12 families) (S)
  5. 248550Family c.68.1.14: Glycogenin [75273] (1 protein)
  6. 248551Protein Glycogenin [75274] (1 species)
  7. 248552Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [75275] (3 PDB entries)
  8. 248563Domain d1ll0i_: 1ll0 I: [74003]

Details for d1ll0i_

PDB Entry: 1ll0 (more details), 3.43 Å

PDB Description: Crystal Structure of Rabbit Muscle Glycogenin

SCOP Domain Sequences for d1ll0i_:

Sequence, based on SEQRES records: (download)

>d1ll0i_ c.68.1.14 (I:) Glycogenin {Rabbit (Oryctolagus cuniculus)}
rgshmtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfd
evitvdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfe
reelsaapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswat
tdirkhlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsegh
dptmthpqflnvwwdifttsvvpllqqfglv

Sequence, based on observed residues (ATOM records): (download)

>d1ll0i_ c.68.1.14 (I:) Glycogenin {Rabbit (Oryctolagus cuniculus)}
rgshmtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfd
evitvdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfe
reelsaapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswat
tdirkhlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsehp
qflnvwwdifttsvvpllqqfglv

SCOP Domain Coordinates for d1ll0i_:

Click to download the PDB-style file with coordinates for d1ll0i_.
(The format of our PDB-style files is described here.)

Timeline for d1ll0i_: