Lineage for d1ll0i1 (1ll0 I:-1-266)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133793Family c.68.1.14: Glycogenin [75273] (2 protein domains)
  6. 2133794Protein Glycogenin [75274] (2 species)
  7. 2133815Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [75275] (15 PDB entries)
  8. 2133839Domain d1ll0i1: 1ll0 I:-1-266 [74003]
    Other proteins in same PDB: d1ll0b2, d1ll0e2, d1ll0i2

Details for d1ll0i1

PDB Entry: 1ll0 (more details), 3.43 Å

PDB Description: Crystal Structure of Rabbit Muscle Glycogenin
PDB Compounds: (I:) glycogenin-1

SCOPe Domain Sequences for d1ll0i1:

Sequence, based on SEQRES records: (download)

>d1ll0i1 c.68.1.14 (I:-1-266) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptm
thpqflnvwwdifttsvvpllqqfglv

Sequence, based on observed residues (ATOM records): (download)

>d1ll0i1 c.68.1.14 (I:-1-266) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsehpqfln
vwwdifttsvvpllqqfglv

SCOPe Domain Coordinates for d1ll0i1:

Click to download the PDB-style file with coordinates for d1ll0i1.
(The format of our PDB-style files is described here.)

Timeline for d1ll0i1: