Lineage for d1ll0c_ (1ll0 C:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 184079Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
  4. 184080Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (12 families) (S)
  5. 184289Family c.68.1.14: Glycogenin [75273] (1 protein)
  6. 184290Protein Glycogenin [75274] (1 species)
  7. 184291Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [75275] (3 PDB entries)
  8. 184296Domain d1ll0c_: 1ll0 C: [73997]

Details for d1ll0c_

PDB Entry: 1ll0 (more details), 3.43 Å

PDB Description: Crystal Structure of Rabbit Muscle Glycogenin

SCOP Domain Sequences for d1ll0c_:

Sequence, based on SEQRES records: (download)

>d1ll0c_ c.68.1.14 (C:) Glycogenin {Rabbit (Oryctolagus cuniculus)}
mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptm
thpqflnvwwdifttsvvpllqqfglv

Sequence, based on observed residues (ATOM records): (download)

>d1ll0c_ c.68.1.14 (C:) Glycogenin {Rabbit (Oryctolagus cuniculus)}
mtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevit
vdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereel
saapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnswattdir
khlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrstmthpqf
lnvwwdifttsvvpllqqfglv

SCOP Domain Coordinates for d1ll0c_:

Click to download the PDB-style file with coordinates for d1ll0c_.
(The format of our PDB-style files is described here.)

Timeline for d1ll0c_: