Lineage for d1ll0b_ (1ll0 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589782Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 589783Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (14 families) (S)
  5. 590115Family c.68.1.14: Glycogenin [75273] (1 protein)
  6. 590116Protein Glycogenin [75274] (1 species)
  7. 590117Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [75275] (3 PDB entries)
  8. 590121Domain d1ll0b_: 1ll0 B: [73996]

Details for d1ll0b_

PDB Entry: 1ll0 (more details), 3.43 Å

PDB Description: Crystal Structure of Rabbit Muscle Glycogenin

SCOP Domain Sequences for d1ll0b_:

Sequence, based on SEQRES records: (download)

>d1ll0b_ c.68.1.14 (B:) Glycogenin {Rabbit (Oryctolagus cuniculus)}
vprgshmtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleiv
fdevitvdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddl
fereelsaapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnsw
attdirkhlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrse
ghdptmthpqflnvwwdifttsvvpllqqfglv

Sequence, based on observed residues (ATOM records): (download)

>d1ll0b_ c.68.1.14 (B:) Glycogenin {Rabbit (Oryctolagus cuniculus)}
vprgshmtdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleiv
fdevitvdildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddl
fereelsaapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggdqgllntffnsw
attdirkhlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsm
thpqflnvwwdifttsvvpllqqfglv

SCOP Domain Coordinates for d1ll0b_:

Click to download the PDB-style file with coordinates for d1ll0b_.
(The format of our PDB-style files is described here.)

Timeline for d1ll0b_: