Lineage for d1lkza2 (1lkz A:127-198)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 413331Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family) (S)
  5. 413332Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein)
  6. 413333Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (3 species)
  7. 413343Species Escherichia coli [TaxId:562] [75448] (3 PDB entries)
  8. 413348Domain d1lkza2: 1lkz A:127-198 [73992]
    Other proteins in same PDB: d1lkza1, d1lkzb1

Details for d1lkza2

PDB Entry: 1lkz (more details), 2.5 Å

PDB Description: crystal structure of d-ribose-5-phosphate isomerase (rpia) from escherichia coli.

SCOP Domain Sequences for d1lkza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkza2 d.58.40.1 (A:127-198) D-ribose-5-phosphate isomerase (RpiA), lid domain {Escherichia coli}
gkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpiamenai
naipgvvtvglf

SCOP Domain Coordinates for d1lkza2:

Click to download the PDB-style file with coordinates for d1lkza2.
(The format of our PDB-style files is described here.)

Timeline for d1lkza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lkza1