SCOPe 2.05: Domain d1lkyf_: 1lky F:

Lineage for d1lkyf_ (1lky F:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.1: Pointed domain [47770] (7 proteins)

6. Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74736] (2 PDB entries)

8. Domain d1lkyf_: 1lky F: [73990]
   complexed with so4

Details for d1lkyf_

PDB Entry: 1lky, 2.3 Å

PDB Description: structure of the wild-type tel-sam polymer

PDB Compounds: (F:) transcription factor etv6

SCOPe Domain Sequences for d1lkyf_:

Sequence; same for both SEQRES and ATOM records:

>d1lkyf_ a.60.1.1 (F:) Etv6 transcription factor pointed domain (Tel SAM) {Human (Homo sapiens) [TaxId: 9606]}
sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkdlllltkedfryrs
phsgdvlyellqhilkq

Timeline for d1lkyf_:

• d1lkyf_ first appeared in SCOP 1.61
  
• d1lkyf_ appears in SCOPe 2.04
  
• d1lkyf_ appears in SCOPe 2.06
  
• d1lkyf_ appears in the current release, SCOPe 2.08