| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) ![]() |
| Family a.60.1.1: Pointed domain [47770] (2 proteins) |
| Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [74736] (2 PDB entries) |
| Domain d1lkyf_: 1lky F: [73990] complexed with so4; mutant |
PDB Entry: 1lky (more details), 2.3 Å
SCOP Domain Sequences for d1lkyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lkyf_ a.60.1.1 (F:) Etv6 transcription factor pointed domain (Tel SAM) {Human (Homo sapiens)}
sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkdlllltkedfryrs
phsgdvlyellqhilkq
Timeline for d1lkyf_: