SCOP 1.73: Domain d1lkyd_: 1lky D:

Lineage for d1lkyd_ (1lky D:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (2 families)

5. Family a.60.1.1: Pointed domain [47770] (6 proteins)

6. Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74736] (2 PDB entries)

8. Domain d1lkyd_: 1lky D: [73988]

Details for d1lkyd_

PDB Entry: 1lky, 2.3 Å

PDB Description: structure of the wild-type tel-sam polymer

PDB Compounds: (D:) transcription factor etv6

SCOP Domain Sequences for d1lkyd_:

Sequence; same for both SEQRES and ATOM records:

>d1lkyd_ a.60.1.1 (D:) Etv6 transcription factor pointed domain (Tel SAM) {Human (Homo sapiens) [TaxId: 9606]}
sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkdlllltkedfryrs
phsgdvlyellqhilkq

Timeline for d1lkyd_:

• d1lkyd_ first appeared in SCOP 1.61
  
• d1lkyd_ appears in SCOP 1.71
  
• d1lkyd_ appears in SCOP 1.75
  
• d1lkyd_ appears in the current release, SCOPe 2.08