Lineage for d1lkyc_ (1lky C:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 770824Superfamily a.60.1: SAM/Pointed domain [47769] (3 families) (S)
  5. 770825Family a.60.1.1: Pointed domain [47770] (6 proteins)
  6. 770835Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species)
  7. 770839Species Human (Homo sapiens) [TaxId:9606] [74736] (2 PDB entries)
  8. 770845Domain d1lkyc_: 1lky C: [73987]

Details for d1lkyc_

PDB Entry: 1lky (more details), 2.3 Å

PDB Description: structure of the wild-type tel-sam polymer
PDB Compounds: (C:) transcription factor etv6

SCOP Domain Sequences for d1lkyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkyc_ a.60.1.1 (C:) Etv6 transcription factor pointed domain (Tel SAM) {Human (Homo sapiens) [TaxId: 9606]}
sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
phsgdrlyellqhilkq

SCOP Domain Coordinates for d1lkyc_:

Click to download the PDB-style file with coordinates for d1lkyc_.
(The format of our PDB-style files is described here.)

Timeline for d1lkyc_: