Lineage for d1lkya_ (1lky A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001089Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2001090Family a.60.1.1: Pointed domain [47770] (7 proteins)
  6. 2001101Protein Etv6 transcription factor pointed domain (Tel SAM) [74735] (2 species)
  7. 2001111Species Human (Homo sapiens) [TaxId:9606] [74736] (2 PDB entries)
  8. 2001115Domain d1lkya_: 1lky A: [73985]
    complexed with so4

Details for d1lkya_

PDB Entry: 1lky (more details), 2.3 Å

PDB Description: structure of the wild-type tel-sam polymer
PDB Compounds: (A:) transcription factor etv6

SCOPe Domain Sequences for d1lkya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkya_ a.60.1.1 (A:) Etv6 transcription factor pointed domain (Tel SAM) {Human (Homo sapiens) [TaxId: 9606]}
sirlpahlrlqpiywsrddvaqwlkwaenefslrpidsntfemngkalllltkedfryrs
phsgdrlyellqhilkq

SCOPe Domain Coordinates for d1lkya_:

Click to download the PDB-style file with coordinates for d1lkya_.
(The format of our PDB-style files is described here.)

Timeline for d1lkya_: