Lineage for d1lkxd_ (1lkx D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111652Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. 2111704Species Slime mold (Dictyostelium discoideum), class-I myosin MyoE [TaxId:44689] [75206] (1 PDB entry)
    lacks the SH3-like insert domain
  8. 2111708Domain d1lkxd_: 1lkx D: [73984]
    complexed with adp, mg, vo4

Details for d1lkxd_

PDB Entry: 1lkx (more details), 3 Å

PDB Description: motor domain of myoe, a class-i myosin
PDB Compounds: (D:) myosin ie heavy chain

SCOPe Domain Sequences for d1lkxd_:

Sequence, based on SEQRES records: (download)

>d1lkxd_ c.37.1.9 (D:) Myosin S1, motor domain {Slime mold (Dictyostelium discoideum), class-I myosin MyoE [TaxId: 44689]}
gvpdfvllnqitenafienltmrhksdniytyigdvvistnpfknlniykesdikayngr
ykyempphmyalandayrsmrqsqenqcviisgesgagkteaskkimqfltfvssnqspn
geriskmlldsnplleafgnaktlrndnssrfgkymemqfnavgspiggkitnylleksr
vvgrtqgersfhifyqmlkglsqskldelgltpnapayeylkksgcfdvstiddsgefki
ivkametlglkesdqnsiwrilaailhignitfaeaaeqrtgtttvkvsdtkslaaaasc
lktdqqslsialcyrsistgvgkrcsvisvpmdcnqaaysrdalakalyerlfnwlvski
ntiincttekgpvigildiygfevfqnnsfeqlninfcneklqqlfieltlkseqeeyvr
egiewknieyfnnkpiceliekkpiglislldeacliakstdqtfldsickqfeknphlq
syvvskdrsigdtcfrlkhyagdvtydvrgfldknkdtlfgdlissmqsssdplvqglfp
ptrpedskkrpetagsqfrnamnalittllacsphyvrciksndnkqagvidedrvrhqv
rylgllenvrvrragfagrieytrfynrykmlckktwpsfngtakqatelilqqhnidke
eirmgktkvfirnpttlfyfeekrelem

Sequence, based on observed residues (ATOM records): (download)

>d1lkxd_ c.37.1.9 (D:) Myosin S1, motor domain {Slime mold (Dictyostelium discoideum), class-I myosin MyoE [TaxId: 44689]}
gvpdfvllnqitenafienltmrhksdniytyigdvvistnpfknlniykesdikayngr
ykyempphmyalandayrsmrqsqenqcviisgesgagkteaskkimqfltfvssnqspn
geriskmlldsnplleafgnaktlrndnssrfgkymemqfnavgspiggkitnylleksr
vvgrtqgersfhifyqmlkglsqskldelgltpnapayeylkksgcfdvstiddsgefki
ivkametlglkesdqnsiwrilaailhignitfaeaaeqrtgtttvkvsdtkslaaaasc
lktdqqslsialcyrsvisvpmdcnqaaysrdalakalyerlfnwlvskintiincttek
gpvigildiygfevfqnnsfeqlninfcneklqqlfieltlkseqeeyvregiewkniey
fnnkpiceliekkpiglislldeacliakstdqtfldsickqfeknphlqsyvvskdrsi
gdtcfrlkhyagdvtydvrgfldknkdtlfgdlissmqsssdplvqglfpetagsqfrna
mnalittllacsphyvrciksndnkqagvidedrvrhqvrylgllenvrvrragfagrie
ytrfynrykmlckktakqatelilqqhnidkeeirmgktkvfirnpttlfyfeekrelem

SCOPe Domain Coordinates for d1lkxd_:

Click to download the PDB-style file with coordinates for d1lkxd_.
(The format of our PDB-style files is described here.)

Timeline for d1lkxd_: