Lineage for d1lkca_ (1lkc A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705329Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 705593Protein L-threonine-O-3-phosphate decarboxylase CobD [69563] (1 species)
  7. 705594Species Salmonella enterica [TaxId:28901] [69564] (4 PDB entries)
  8. 705597Domain d1lkca_: 1lkc A: [73978]
    complexed with egl, plp, po4

Details for d1lkca_

PDB Entry: 1lkc (more details), 1.8 Å

PDB Description: Crystal Structure of L-Threonine-O-3-Phosphate Decarboxylase from Salmonella enterica
PDB Compounds: (A:) L-Threonine-O-3-Phosphate Decarboxylase

SCOP Domain Sequences for d1lkca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkca_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]}
hggnirepatvlgispdqlldfsaninplgmpvsvkralidnldcierypdadyfhlhqa
larhhqvpaswilagngetesiftvasglkprramivtpgfaeygralaqsgceirrwsl
readgwqltdailealtpdldclflctpnnptgllperpllqaiadrckslninlildea
fidfiphetgfipalkdnphiwvlrsltkfyaipglrlgylvnsddaamarmrrqqmpws
vnalaalagevalqdsawqqatwhwlreegarfyqalcqlplltvypgranylllrcere
didlqrrlltqrilirscanypgldsryyrvairsaaqnerllaalrnvltgiap

SCOP Domain Coordinates for d1lkca_:

Click to download the PDB-style file with coordinates for d1lkca_.
(The format of our PDB-style files is described here.)

Timeline for d1lkca_: