Lineage for d1lkaa_ (1lka A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056282Protein Elastase [50536] (4 species)
  7. 2056299Species Pig (Sus scrofa) [TaxId:9823] [50538] (118 PDB entries)
  8. 2056339Domain d1lkaa_: 1lka A: [73976]
    complexed with act, ca, cl

Details for d1lkaa_

PDB Entry: 1lka (more details), 1.7 Å

PDB Description: Porcine Pancreatic Elastase/Ca-Complex
PDB Compounds: (A:) Elastase 1

SCOPe Domain Sequences for d1lkaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkaa_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d1lkaa_:

Click to download the PDB-style file with coordinates for d1lkaa_.
(The format of our PDB-style files is described here.)

Timeline for d1lkaa_: