Lineage for d1lk7c2 (1lk7 C:131-210)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955594Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family) (S)
  5. 2955595Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein)
  6. 2955596Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (4 species)
  7. 2955607Species Pyrococcus horikoshii [TaxId:53953] [75449] (2 PDB entries)
  8. 2955614Domain d1lk7c2: 1lk7 C:131-210 [73973]
    Other proteins in same PDB: d1lk7a1, d1lk7b1, d1lk7c1, d1lk7d1
    complexed with cl, der, na

Details for d1lk7c2

PDB Entry: 1lk7 (more details), 2 Å

PDB Description: Structure of D-Ribose-5-Phosphate Isomerase from in complex with phospho-erythronic acid
PDB Compounds: (C:) D-Ribose-5-Phosphate Isomerase

SCOPe Domain Sequences for d1lk7c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lk7c2 d.58.40.1 (C:131-210) D-ribose-5-phosphate isomerase (RpiA), lid domain {Pyrococcus horikoshii [TaxId: 53953]}
cqkmpvpievipqawkaiieelsifnakaelrmgvnkdgpvitdngnfiidakfpriddp
ldmeielntipgviengifa

SCOPe Domain Coordinates for d1lk7c2:

Click to download the PDB-style file with coordinates for d1lk7c2.
(The format of our PDB-style files is described here.)

Timeline for d1lk7c2: