SCOP 1.69: Domain d1lk7b1: 1lk7 B:1-130,B:211-229

Lineage for d1lk7b1 (1lk7 B:1-130,B:211-229)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (6 families)

5. Family c.124.1.4: D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75176] (1 protein)
   share a common phosphate-binding site with the NagB-like family; part of sheet is folded upon itself and forms a barrel-like structure like the CoA transferase subunits

6. Protein D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75177] (4 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [75179] (2 PDB entries)

8. Domain d1lk7b1: 1lk7 B:1-130,B:211-229 [73970]
   Other proteins in same PDB: d1lk7a2, d1lk7b2, d1lk7c2, d1lk7d2

Details for d1lk7b1

PDB Entry: 1lk7, 2 Å

PDB Description: Structure of D-Ribose-5-Phosphate Isomerase from in complex with phospho-erythronic acid

SCOP Domain Sequences for d1lk7b1:

Sequence; same for both SEQRES and ATOM records:

>d1lk7b1 c.124.1.4 (B:1-130,B:211-229) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Archaeon Pyrococcus horikoshii}
mnveemkkiaakealkfieddmviglgtgsttayfikllgeklkrgeisdivgvptsyqa
kllaiehdipiasldqvdaidvavdgadevdpnlnlikgrgaaltmekiieyragtfivl
vderklvdylXdiadivivgtregvkkler

Timeline for d1lk7b1:

• d1lk7b1 first appeared in SCOP 1.61
  
• d1lk7b1 appears in SCOP 1.67
  
• d1lk7b1 appears in SCOP 1.71
  
• d1lk7b1 appears in the current release, SCOPe 2.08