SCOPe 2.06: Domain d1lk7a1: 1lk7 A:1-130,A:211-229

Lineage for d1lk7a1 (1lk7 A:1-130,A:211-229)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.4: D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75176] (1 protein)
   share a common phosphate-binding site with the NagB-like family; part of sheet is folded upon itself and forms a barrel-like structure like the CoA transferase subunits

6. Protein D-ribose-5-phosphate isomerase (RpiA), catalytic domain [75177] (4 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [75179] (2 PDB entries)

8. Domain d1lk7a1: 1lk7 A:1-130,A:211-229 [73968]
   Other proteins in same PDB: d1lk7a2, d1lk7b2, d1lk7c2, d1lk7d2
   complexed with cl, der, na

Details for d1lk7a1

PDB Entry: 1lk7, 2 Å

PDB Description: Structure of D-Ribose-5-Phosphate Isomerase from in complex with phospho-erythronic acid

PDB Compounds: (A:) D-Ribose-5-Phosphate Isomerase

SCOPe Domain Sequences for d1lk7a1:

Sequence; same for both SEQRES and ATOM records:

>d1lk7a1 c.124.1.4 (A:1-130,A:211-229) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mnveemkkiaakealkfieddmviglgtgsttayfikllgeklkrgeisdivgvptsyqa
kllaiehdipiasldqvdaidvavdgadevdpnlnlikgrgaaltmekiieyragtfivl
vderklvdylXdiadivivgtregvkkler

Timeline for d1lk7a1:

• d1lk7a1 first appeared in SCOP 1.61
  
• d1lk7a1 appears in SCOPe 2.05
  
• d1lk7a1 appears in SCOPe 2.07
  
• d1lk7a1 appears in the current release, SCOPe 2.08