Lineage for d1lk5a2 (1lk5 A:131-210)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562432Superfamily d.58.40: D-ribose-5-phosphate isomerase (RpiA), lid domain [75445] (1 family) (S)
  5. 2562433Family d.58.40.1: D-ribose-5-phosphate isomerase (RpiA), lid domain [75446] (1 protein)
  6. 2562434Protein D-ribose-5-phosphate isomerase (RpiA), lid domain [75447] (4 species)
  7. 2562445Species Pyrococcus horikoshii [TaxId:53953] [75449] (2 PDB entries)
  8. 2562446Domain d1lk5a2: 1lk5 A:131-210 [73961]
    Other proteins in same PDB: d1lk5a1, d1lk5b1, d1lk5c1, d1lk5d1
    complexed with cl, na

Details for d1lk5a2

PDB Entry: 1lk5 (more details), 1.75 Å

PDB Description: Structure of the D-Ribose-5-Phosphate Isomerase from Pyrococcus horikoshii
PDB Compounds: (A:) D-Ribose-5-Phosphate Isomerase

SCOPe Domain Sequences for d1lk5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lk5a2 d.58.40.1 (A:131-210) D-ribose-5-phosphate isomerase (RpiA), lid domain {Pyrococcus horikoshii [TaxId: 53953]}
cqkmpvpievipqawkaiieelsifnakaelrmgvnkdgpvitdngnfiidakfpriddp
ldmeielntipgviengifa

SCOPe Domain Coordinates for d1lk5a2:

Click to download the PDB-style file with coordinates for d1lk5a2.
(The format of our PDB-style files is described here.)

Timeline for d1lk5a2: