SCOPe 2.07: Domain d1lk3m2: 1lk3 M:107-210

Lineage for d1lk3m2 (1lk3 M:107-210)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88568] (10 PDB entries)

8. Domain d1lk3m2: 1lk3 M:107-210 [73959]
   Other proteins in same PDB: d1lk3a_, d1lk3b_, d1lk3h1, d1lk3h2, d1lk3i1, d1lk3i2, d1lk3l1, d1lk3m1
   part of anti-IL-10 Fab 9D7

Details for d1lk3m2

PDB Entry: 1lk3, 1.91 Å

PDB Description: engineered human interleukin-10 monomer complexed to 9d7 fab fragment

PDB Compounds: (M:) 9D7 Light Chain

SCOPe Domain Sequences for d1lk3m2:

Sequence; same for both SEQRES and ATOM records:

>d1lk3m2 b.1.1.2 (M:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnr

Timeline for d1lk3m2:

• d1lk3m2 first appeared in SCOP 1.61
  
• d1lk3m2 appears in SCOPe 2.06
  
• d1lk3m2 appears in the current release, SCOPe 2.08