Lineage for d1lk3m2 (1lk3 M:107-210)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656543Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (5 PDB entries)
  8. 656545Domain d1lk3m2: 1lk3 M:107-210 [73959]
    Other proteins in same PDB: d1lk3a_, d1lk3b_, d1lk3h1, d1lk3h2, d1lk3i1, d1lk3i2, d1lk3l1, d1lk3m1
    part of anti-IL-10 Fab 9D7

Details for d1lk3m2

PDB Entry: 1lk3 (more details), 1.91 Å

PDB Description: engineered human interleukin-10 monomer complexed to 9d7 fab fragment
PDB Compounds: (M:) 9D7 Light Chain

SCOP Domain Sequences for d1lk3m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lk3m2 b.1.1.2 (M:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnr

SCOP Domain Coordinates for d1lk3m2:

Click to download the PDB-style file with coordinates for d1lk3m2.
(The format of our PDB-style files is described here.)

Timeline for d1lk3m2: