Lineage for d1lk3m1 (1lk3 M:1-106)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219112Species Anti-IL-10 Fab 9D7 (rat), kappa L chain [74820] (1 PDB entry)
  8. 219116Domain d1lk3m1: 1lk3 M:1-106 [73958]
    Other proteins in same PDB: d1lk3a_, d1lk3b_, d1lk3h2, d1lk3i2, d1lk3l2, d1lk3m2

Details for d1lk3m1

PDB Entry: 1lk3 (more details), 1.91 Å

PDB Description: engineered human interleukin-10 monomer complexed to 9d7 fab fragment

SCOP Domain Sequences for d1lk3m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lk3m1 b.1.1.1 (M:1-106) Immunoglobulin (variable domains of L and H chains) {Anti-IL-10 Fab 9D7 (rat), kappa L chain}
dtvltqppaltvspgekltisckasesvtsrmhwyqqkpgqqpklliykasnlasgvpar
fsgsgsgtdftltidpveaddtaiyfcqqswngpltfgagtklelk

SCOP Domain Coordinates for d1lk3m1:

Click to download the PDB-style file with coordinates for d1lk3m1.
(The format of our PDB-style files is described here.)

Timeline for d1lk3m1: