![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
![]() | Species Anti IL-10 Fab 9D7 (rat), kappa L chain [74820] (1 PDB entry) |
![]() | Domain d1lk3m1: 1lk3 M:1-106 [73958] Other proteins in same PDB: d1lk3a_, d1lk3b_, d1lk3h2, d1lk3i2, d1lk3l2, d1lk3m2 |
PDB Entry: 1lk3 (more details), 1.91 Å
SCOP Domain Sequences for d1lk3m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lk3m1 b.1.1.1 (M:1-106) Immunoglobulin (variable domains of L and H chains) {Anti IL-10 Fab 9D7 (rat), kappa L chain} dtvltqppaltvspgekltisckasesvtsrmhwyqqkpgqqpklliykasnlasgvpar fsgsgsgtdftltidpveaddtaiyfcqqswngpltfgagtklelk
Timeline for d1lk3m1: