Lineage for d1lk3l2 (1lk3 L:107-210)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289993Species Rat (Rattus norvegicus) [TaxId:10116] [88568] (4 PDB entries)
  8. 289994Domain d1lk3l2: 1lk3 L:107-210 [73957]
    Other proteins in same PDB: d1lk3a_, d1lk3b_, d1lk3h1, d1lk3h2, d1lk3i1, d1lk3i2, d1lk3l1, d1lk3m1

Details for d1lk3l2

PDB Entry: 1lk3 (more details), 1.91 Å

PDB Description: engineered human interleukin-10 monomer complexed to 9d7 fab fragment

SCOP Domain Sequences for d1lk3l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lk3l2 b.1.1.2 (L:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Rat (Rattus norvegicus)}
radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd
skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnr

SCOP Domain Coordinates for d1lk3l2:

Click to download the PDB-style file with coordinates for d1lk3l2.
(The format of our PDB-style files is described here.)

Timeline for d1lk3l2: