Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Anti-IL-10 Fab 9D7 (rat), kappa L chain [74836] (1 PDB entry) |
Domain d1lk3l2: 1lk3 L:107-210 [73957] Other proteins in same PDB: d1lk3a_, d1lk3b_, d1lk3h1, d1lk3i1, d1lk3l1, d1lk3m1 |
PDB Entry: 1lk3 (more details), 1.91 Å
SCOP Domain Sequences for d1lk3l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lk3l2 b.1.1.2 (L:107-210) Immunoglobulin (constant domains of L and H chains) {Anti-IL-10 Fab 9D7 (rat), kappa L chain} radaaptvsifppsteqlatggasvvclmnnfyprdisvkwkidgterrdgvldsvtdqd skdstysmsstlsltkadyeshnlytcevvhktssspvvksfnr
Timeline for d1lk3l2: