Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins) |
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Rat (Rattus norvegicus) [TaxId:10116] [88532] (7 PDB entries) |
Domain d1lk3l1: 1lk3 L:1-106 [73956] Other proteins in same PDB: d1lk3a_, d1lk3b_, d1lk3h1, d1lk3h2, d1lk3i1, d1lk3i2, d1lk3l2, d1lk3m2 |
PDB Entry: 1lk3 (more details), 1.91 Å
SCOP Domain Sequences for d1lk3l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus)} dtvltqppaltvspgekltisckasesvtsrmhwyqqkpgqqpklliykasnlasgvpar fsgsgsgtdftltidpveaddtaiyfcqqswngpltfgagtklelk
Timeline for d1lk3l1: