Lineage for d1lk3l1 (1lk3 L:1-106)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157423Species Anti IL-10 Fab 9D7 (rat), kappa L chain [74820] (1 PDB entry)
  8. 157426Domain d1lk3l1: 1lk3 L:1-106 [73956]
    Other proteins in same PDB: d1lk3a_, d1lk3b_, d1lk3h2, d1lk3i2, d1lk3l2, d1lk3m2

Details for d1lk3l1

PDB Entry: 1lk3 (more details), 1.91 Å

PDB Description: engineered human interleukin-10 monomer complexed to 9d7 fab fragment
PDB Compounds: (L:)

SCOP Domain Sequences for d1lk3l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin (variable domains of L and H chains) {Anti IL-10 Fab 9D7 (rat), kappa L chain}
dtvltqppaltvspgekltisckasesvtsrmhwyqqkpgqqpklliykasnlasgvpar
fsgsgsgtdftltidpveaddtaiyfcqqswngpltfgagtklelk

SCOP Domain Coordinates for d1lk3l1:

Click to download the PDB-style file with coordinates for d1lk3l1.
(The format of our PDB-style files is described here.)

Timeline for d1lk3l1: