Lineage for d1lk3i2 (1lk3 I:120-219)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221008Species Anti-IL-10 Fab 9D7 (rat), kappa L chain [74836] (1 PDB entry)
  8. 221010Domain d1lk3i2: 1lk3 I:120-219 [73955]
    Other proteins in same PDB: d1lk3a_, d1lk3b_, d1lk3h1, d1lk3i1, d1lk3l1, d1lk3m1

Details for d1lk3i2

PDB Entry: 1lk3 (more details), 1.91 Å

PDB Description: engineered human interleukin-10 monomer complexed to 9d7 fab fragment

SCOP Domain Sequences for d1lk3i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lk3i2 b.1.1.2 (I:120-219) Immunoglobulin (constant domains of L and H chains) {Anti-IL-10 Fab 9D7 (rat), kappa L chain}
aettapsvyplapgtalksnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsg
lytltssvtvpsstwpsqtvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1lk3i2:

Click to download the PDB-style file with coordinates for d1lk3i2.
(The format of our PDB-style files is described here.)

Timeline for d1lk3i2: