Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [88578] (5 PDB entries) |
Domain d1lk3h2: 1lk3 H:120-219 [73953] Other proteins in same PDB: d1lk3a_, d1lk3b_, d1lk3h1, d1lk3i1, d1lk3l1, d1lk3l2, d1lk3m1, d1lk3m2 part of anti-IL-10 Fab 9D7 |
PDB Entry: 1lk3 (more details), 1.91 Å
SCOP Domain Sequences for d1lk3h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lk3h2 b.1.1.2 (H:120-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} aettapsvyplapgtalksnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsg lytltssvtvpsstwpsqtvtcnvahpasstkvdkkivpr
Timeline for d1lk3h2: